GET /api/protein/UniProt/G5QM42/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G5QM42",
"id": "G5QM42_SALRU",
"source_organism": {
"taxId": "913081",
"scientificName": "Salmonella enterica subsp. enterica serovar Rubislaw str. A4-653",
"fullName": "Salmonella enterica subsp. enterica serovar Rubislaw str. A4-653"
},
"name": "Penicillin-insensitive murein endopeptidase",
"description": [
"Murein endopeptidase that cleaves the D-alanyl-meso-2,6-diamino-pimelyl amide bond that connects peptidoglycan strands. Likely plays a role in the removal of murein from the sacculus"
],
"length": 274,
"sequence": "MKKTAIALLAWFVSSASLAATPWQKITHPVPGAAQSIGSFANGCIIGADTLPVQSDNYQVMRTDQRRYFGHPDLVMFIQRLSHQAQQRGLGTVLIGDMGMPAGGRFNGGHASHQTGLDVDIFLQLPKTRWSQAQLLRPQALDLVSRDGKHVVPSRWSSDIASLIKLAAQDNDVTRIFVNPAIKQQLCLDAGNDRDWLRKVRPWFQHRAHMHVRLRCPADSLECEDQPLPPPGDGCGAELQSWFEPPKPGTTKPEKKTPPPLPPSCQALLDEHVL",
"proteome": null,
"gene": "mepA",
"go_terms": [
{
"identifier": "GO:0004252",
"name": "serine-type endopeptidase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006508",
"name": "proteolysis",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0030288",
"name": "outer membrane-bounded periplasmic space",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e511fef371fecdc4050b8162841c2d10e6f7e9f1",
"counters": {
"domain_architectures": 4273,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"pirsf": 1,
"ncbifam": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 4273
}
}
}