HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G5Q8J9",
"id": "G5Q8J9_SALMO",
"source_organism": {
"taxId": "913242",
"scientificName": "Salmonella enterica subsp. enterica serovar Montevideo str. S5-403",
"fullName": "Salmonella enterica subsp. enterica serovar Montevideo str. S5-403"
},
"name": "HTH-type transcriptional regulator ZntR",
"description": [
"Zinc-responsive transcriptional regulator of zntA"
],
"length": 141,
"sequence": "MYRIGELAKLADVTPDTIRYYEKQQMMDHEVRTEGGFRLYTENDLQRLKFIRYARQLGFTLDSIRELLSIRIDPEHHTCQESKSIVQERLQEVEARIAELQTMQRSLQRLNDACCGTAHSSVYCSILEALEQGASGAKSGC",
"proteome": null,
"gene": "LTSEMON_4704",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006355",
"name": "regulation of DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003700",
"name": "DNA-binding transcription factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008270",
"name": "zinc ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006351",
"name": "DNA-templated transcription",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "c4db4cb6ae5d1724276ba6e39169f8f8c6eb51d3",
"counters": {
"domain_architectures": 113891,
"entries": 15,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"cathgene3d": 1,
"smart": 1,
"ssf": 1,
"cdd": 1,
"panther": 1,
"ncbifam": 2,
"pfam": 1,
"prosite": 1,
"prints": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 113891
}
}
}