GET /api/protein/UniProt/G5GH53/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G5GH53",
        "id": "G5GH53_9FIRM",
        "source_organism": {
            "taxId": "679200",
            "scientificName": "Johnsonella ignava ATCC 51276",
            "fullName": "Johnsonella ignava ATCC 51276"
        },
        "name": "Ribulose-phosphate 3-epimerase",
        "description": [
            "Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate"
        ],
        "length": 219,
        "sequence": "MVTLSPSLLAADFVNLRSQIDILKLNGIRSLHLDIMDGMYVPNISFGPPVIKSLRKYTDMFLDVHMMVEAPERYIDDMIYAGADSITLHIETCRHLDSALEKIRKSGKKTGVALNPATPVLLLDEILPFVDMVLVMSVNPGFGGQQFIEYTKRKIERLKAIKSDNALSYSIQVDGGVNKENIADIAEAGADNIVAGSAIFSGDISDNIRFLKGLLEERE",
        "proteome": "UP000003011",
        "gene": "rpe",
        "go_terms": [
            {
                "identifier": "GO:0016857",
                "name": "racemase and epimerase activity, acting on carbohydrates and derivatives",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005975",
                "name": "carbohydrate metabolic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0004750",
                "name": "D-ribulose-phosphate 3-epimerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006098",
                "name": "pentose-phosphate shunt",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7b50f47d103c0624353a9afbf8e5c3e260b2c8e1",
        "counters": {
            "domain_architectures": 36229,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "pfam": 1,
                "cdd": 1,
                "hamap": 1,
                "ncbifam": 2,
                "pirsf": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 36229
        }
    }
}