HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G5GH53",
"id": "G5GH53_9FIRM",
"source_organism": {
"taxId": "679200",
"scientificName": "Johnsonella ignava ATCC 51276",
"fullName": "Johnsonella ignava ATCC 51276"
},
"name": "Ribulose-phosphate 3-epimerase",
"description": [
"Catalyzes the reversible epimerization of D-ribulose 5-phosphate to D-xylulose 5-phosphate"
],
"length": 219,
"sequence": "MVTLSPSLLAADFVNLRSQIDILKLNGIRSLHLDIMDGMYVPNISFGPPVIKSLRKYTDMFLDVHMMVEAPERYIDDMIYAGADSITLHIETCRHLDSALEKIRKSGKKTGVALNPATPVLLLDEILPFVDMVLVMSVNPGFGGQQFIEYTKRKIERLKAIKSDNALSYSIQVDGGVNKENIADIAEAGADNIVAGSAIFSGDISDNIRFLKGLLEERE",
"proteome": "UP000003011",
"gene": "rpe",
"go_terms": [
{
"identifier": "GO:0016857",
"name": "racemase and epimerase activity, acting on carbohydrates and derivatives",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005975",
"name": "carbohydrate metabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0004750",
"name": "D-ribulose-phosphate 3-epimerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006098",
"name": "pentose-phosphate shunt",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7b50f47d103c0624353a9afbf8e5c3e260b2c8e1",
"counters": {
"domain_architectures": 36229,
"entries": 15,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 2,
"pirsf": 1,
"panther": 1,
"prosite": 2,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 36229
}
}
}