HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G5B6W2",
"id": "G5B6W2_HETGA",
"source_organism": {
"taxId": "10181",
"scientificName": "Heterocephalus glaber",
"fullName": "Heterocephalus glaber (Naked mole rat)"
},
"name": "Actin-related protein 2/3 complex subunit 5",
"description": [
"Functions as component of the Arp2/3 complex which is involved in regulation of actin polymerization and together with an activating nucleation-promoting factor (NPF) mediates the formation of branched actin networks. Arp2/3 complex plays a critical role in the control of cell morphogenesis via the modulation of cell polarity development"
],
"length": 153,
"sequence": "MARNTLSSRFRRVDIDEFDENKFVDEQEEAAAAAGEPGPDPSEVDGLLRQWDMLRAFHAALRNSPVNTKNQAVKERAQSVVLKVLTNFKSSEIEQAVQSLDRNGIDLLMKYIYKGFEKPTENSSAVLLQWHEKALAVGGLGSIIRVLTARKTV",
"proteome": null,
"gene": "GW7_01141",
"go_terms": [
{
"identifier": "GO:0030833",
"name": "regulation of actin filament polymerization",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0034314",
"name": "Arp2/3 complex-mediated actin nucleation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005885",
"name": "Arp2/3 protein complex",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0015629",
"name": "actin cytoskeleton",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "0e45d84588e85f9086ccff9a45d337a9812bc30a",
"counters": {
"domain_architectures": 5083,
"entries": 7,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"pirsf": 1,
"panther": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 5083
}
}
}