General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G5B5R6",
        "id": "G5B5R6_HETGA",
        "source_organism": {
            "taxId": "10181",
            "scientificName": "Heterocephalus glaber",
            "fullName": "Heterocephalus glaber (Naked mole rat)"
        },
        "name": "Ribonuclease K6",
        "description": [
            "Ribonuclease which shows a preference for the pyrimidines uridine and cytosine. Has potent antibacterial activity against a range of Gram-positive and Gram-negative bacteria, including P.aeruginosa, A.baumanii, M.luteus, S.aureus, E.faecalis, E.faecium, S.saprophyticus and E.coli. Causes loss of bacterial membrane integrity, and also promotes agglutination of Gram-negative bacteria. Probably contributes to urinary tract sterility. Bactericidal activity is independent of RNase activity"
        ],
        "length": 151,
        "sequence": "MVRDVRFPLLLLLGLLVLPCPLWALPKKLTKAQWFEIQHVQPSPLRCDKAMSGVNNYTRHCKPTNTFLHDSFQNVSDSCTSPNVTCKNGQKNCHQSASPVNLTICRLTRGKYPHCPYKDVPQIKFFIVACEPPRKNDPPYPLVPVHLDGIV",
        "proteome": "UP000694906",
        "gene": "RNASE6",
        "go_terms": [
            {
                "identifier": "GO:0003676",
                "name": "nucleic acid binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "98d68b12bd3f8712f6c8af8279bf34350ea81404",
        "counters": {
            "domain_architectures": 4309,
            "entries": 12,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4309
        }
    }
}