GET /api/protein/UniProt/G5ATV2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G5ATV2",
"id": "G5ATV2_HETGA",
"source_organism": {
"taxId": "10181",
"scientificName": "Heterocephalus glaber",
"fullName": "Heterocephalus glaber (Naked mole rat)"
},
"name": "Translation initiation factor IF-3, mitochondrial",
"description": [
"IF-3 binds to the 28S ribosomal subunit and shifts the equilibrium between 55S ribosomes and their 39S and 28S subunits in favor of the free subunits, thus enhancing the availability of 28S subunits on which protein synthesis initiation begins"
],
"length": 276,
"sequence": "MAALLLKKLMLQTIKTENKGIRRCFGKYMVQKTVPAPLSLAASAPRLTSLLHAKCFSAVEDTQDGRKKKPNDRTLTNTGRKIHARIIRVFDEKGSDLGNMHRADVIRLMDERDLRLVQRSTSVEPPEYQLMTGMQIHQERLKLREQEKAKPKAGPTVTKELTFSSNIGQHDLNTKSKQIQLWIEKKYQVQITIKKGKNADEPENKTEEIFHEILQTMPGVATFLSRPQAVKGGRALMCVLRHLNKKEKEYADSQIQKTDTLNKKNGNGRESDVVHS",
"proteome": "UP000694906",
"gene": "Mtif3",
"go_terms": [
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4f2e917ceddd49ceaba555f6d4dd5f8821a6a3a0",
"counters": {
"domain_architectures": 1609,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1609
}
}
}