General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G5A3E5",
        "id": "G5A3E5_PHYSP",
        "source_organism": {
            "taxId": "1094619",
            "scientificName": "Phytophthora sojae (strain P6497)",
            "fullName": "Phytophthora sojae (strain P6497) (Soybean stem and root rot agent)"
        },
        "name": "Uncharacterized protein",
        "description": [
            "May catalyze the cis-trans isomerization of proline imidic peptide bonds in oligopeptides thereby assisting the folding of proteins. May also function as a chaperone, playing a role in intracellular transport of proteins. May also have a protein ubiquitin ligase activity acting as an E3 ubiquitin protein ligase or as a ubiquitin-ubiquitin ligase promoting elongation of ubiquitin chains on proteins"
        ],
        "length": 577,
        "sequence": "MGKNRHSKDRLFITQTEHKYLYGGKKQEIRRAYKRLPFNCCAITLCPFTNPVCTREGHLFDLEAVVPYVKEHQINPVTGKPLALKELIQLHFSKNSQGEYFCPVTYKVFTDNTKIAAIATTGNVFCYEAVEELNVKPKNWTDLISGAKFKRKDIVILQDPQDFSNREIDNFEHLRRAKASDNSASTTAAARNIRTNAATDRILQELEAKKAAQKELTEKIKRGADDVCEKDKIVASLTHSKQSQAEEKIAAKKTAQSGKLQYSQFTAGDCSSSFTSSVRAPVTSNAVALASEQELLERRWQAVRKLKKKGLVRLETTLGNINLEVDCDFVPQTADNFMSLCQSKYYDGVLFHRVIKGFMMQGGDPTGTGRGGQSIWKKPFRDEIDSRLSHDARGVLSMANSGPATNNSQFFITFKACPHLDKKHAVFGRVVGGMDVLDAVENVETGAEDQPIEDVRIKSVQVFTNPFQEYEEAQERGLDVVQVAKEKAAQDAKPKVQGTVLKVGGKWVAYDDLGEVDVASIPTCETTKDENVGKYLQTKSDAATKKRSLEPTMPTAIESKKKSKKQSSSGFGNFSGW",
        "proteome": "UP000002640",
        "gene": "PHYSODRAFT_521528",
        "go_terms": [
            {
                "identifier": "GO:0004842",
                "name": "ubiquitin-protein transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016567",
                "name": "protein ubiquitination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0003755",
                "name": "peptidyl-prolyl cis-trans isomerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000413",
                "name": "protein peptidyl-prolyl isomerization",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006457",
                "name": "protein folding",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "6237a4c31c562a046eb1734f7eb5e3a41db6685d",
        "counters": {
            "domain_architectures": 752,
            "entries": 21,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 4,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 2,
                "ssf": 2,
                "cdd": 2,
                "smart": 1,
                "cathgene3d": 2,
                "pfam": 2,
                "panther": 1,
                "prosite": 1,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 752
        }
    }
}