General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G4RLB5",
        "id": "G4RLB5_THETK",
        "source_organism": {
            "taxId": "768679",
            "scientificName": "Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1)",
            "fullName": "Thermoproteus tenax (strain ATCC 35583 / DSM 2078 / JCM 9277 / NBRC 100435 / Kra 1)"
        },
        "name": "Exosome complex component Csl4",
        "description": [
            "Non-catalytic component of the exosome, which is a complex involved in RNA degradation. Increases the RNA binding and the efficiency of RNA degradation. Helpful for the interaction of the exosome with A-poor RNAs"
        ],
        "length": 178,
        "sequence": "MSVKRKLVLPGEEVAMPEEFMVEGSSYLDSVFRSSALGYVVYDSLSHTAVVKPFKRDSYPRQGDILYCVVTSKGVRALNVRCVAREMKEGFEELKYPVTGLIPPQLVDGKVGIGDYVRARVVSNYGPPFLLSIRGSTFGVVRAVCPKCGNVMRRRGGILVCPVCGATAVRKIAHGFYV",
        "proteome": "UP000002654",
        "gene": "csl4",
        "go_terms": [
            {
                "identifier": "GO:0006396",
                "name": "RNA processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0000178",
                "name": "exosome (RNase complex)",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1
        }
    }
}