HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G4R919",
"id": "G4R919_PELHB",
"source_organism": {
"taxId": "1082931",
"scientificName": "Pelagibacterium halotolerans (strain DSM 22347 / JCM 15775 / CGMCC 1.7692 / B2)",
"fullName": "Pelagibacterium halotolerans (strain DSM 22347 / JCM 15775 / CGMCC 1.7692 / B2)"
},
"name": "Cyanate hydratase",
"description": [
"Catalyzes the reaction of cyanate with bicarbonate to produce ammonia and carbon dioxide"
],
"length": 146,
"sequence": "MNKADVTDMILEKKRATGITWGEIAEGIGMSDVFTTSACLGMNAFPREKADILARNLGLPQEAAVVLAEYPTKVFSQSVPTDPAVYRLYEIVGVYGDTIKELINEKAGNGIMSAIDFEMSVEKVPNAKGDRIELKISGKYLEYKSW",
"proteome": "UP000008850",
"gene": "cynS",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009440",
"name": "cyanate catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008824",
"name": "cyanate hydratase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "f8e3eab37ce2e4e7d0eab361a76eb7e715f8b4f5",
"counters": {
"domain_architectures": 4123,
"entries": 19,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 2,
"cathgene3d": 2,
"pfam": 2,
"smart": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 2,
"panther": 1,
"pirsf": 1,
"prints": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 4123
}
}
}