General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3WHH0",
        "id": "G3WHH0_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "Transcription factor LBX1",
        "description": [
            "Transcription factor required for the development of GABAergic interneurons in the dorsal horn of the spinal cord and migration and further development of hypaxial muscle precursor cells for limb muscles, diaphragm and hypoglossal cord"
        ],
        "length": 275,
        "sequence": "MTSKEEGKASSGEERRRSPLDHLPPPANSNKPLTPFSIEDILNKPSVRRSYSLCGAAHLLSAADKHSPGSLPLAGRALLSQTSPLCALEELASKTFKGLEVSVLQAAEGRDGMTIFGQRQTPKKRRKSRTAFTNHQIYELEKRFLYQKYLSPADRDQIAQQLGLTNAQVITWFQNRRAKLKRDLEEMKADVESAKKLGPSSQVDIVALAELEQNSEAGGGRPKSRPNSPVLSAGPPQAPGVGHLQLSPASPLTDQPASSQDCSEDEEDVEIDVDD",
        "proteome": "UP000007648",
        "gene": "LBX1",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0000981",
                "name": "DNA-binding transcription factor activity, RNA polymerase II-specific",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006355",
                "name": "regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "1cca9db9652b5e6e0313f2eed7be72cec278d12f",
        "counters": {
            "domain_architectures": 145457,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "cdd": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 145457
        }
    }
}