GET /api/protein/UniProt/G3WFP5/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3WFP5",
"id": "G3WFP5_SARHA",
"source_organism": {
"taxId": "9305",
"scientificName": "Sarcophilus harrisii",
"fullName": "Sarcophilus harrisii (Tasmanian devil)"
},
"name": "Endoplasmic reticulum resident protein 44",
"description": [
"Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1A and ERO1B in the endoplasmic reticulum"
],
"length": 405,
"sequence": "MLPAAFGYGMLLHVILYTITWIFTPITAEIASLDSGNIDEILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYPNKNQVVFARVDCDQHSEIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSDPIQEVHDLEEIKFLDRSKRTIIGYFEQKDSDNYRTFERVANILHDDCVFFSAFGSVSKPERFSGDNIIYKPPGENAPDMVYLGSLTNFDLAYAWTQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTMSLDVFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDFKDLSIPNKLKQFVLDLHSGKLHREFHHGPDPTDVAPGQHIQDVASSPPESSFQKLAPSEYRYTLLRDRDEL",
"proteome": "UP000007648",
"gene": "ERP44",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "d56d3b555281ff9ca7f6f317f5e3b42df8e05b8e",
"counters": {
"domain_architectures": 5737,
"entries": 14,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 1,
"ssf": 1,
"cathgene3d": 1,
"cdd": 3,
"pfam": 2,
"panther": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5737
}
}
}