General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3WFP5",
        "id": "G3WFP5_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "Endoplasmic reticulum resident protein 44",
        "description": [
            "Mediates thiol-dependent retention in the early secretory pathway, forming mixed disulfides with substrate proteins through its conserved CRFS motif. Inhibits the calcium channel activity of ITPR1. May have a role in the control of oxidative protein folding in the endoplasmic reticulum. Required to retain ERO1A and ERO1B in the endoplasmic reticulum"
        ],
        "length": 405,
        "sequence": "MLPAAFGYGMLLHVILYTITWIFTPITAEIASLDSGNIDEILNNADVALVNFYADWCRFSQMLHPIFEEASNVIKEEYPNKNQVVFARVDCDQHSEIAQRYRISKYPTLKLFRNGMMMKREYRGQRSVTAIADYIRQQKSDPIQEVHDLEEIKFLDRSKRTIIGYFEQKDSDNYRTFERVANILHDDCVFFSAFGSVSKPERFSGDNIIYKPPGENAPDMVYLGSLTNFDLAYAWTQDKCVPLVREITFENGEELTEEGLPFLILFHMKEDTMSLDVFQNEVARQLISEKGTINFLHADCDKFRHPLLHIQKTPADCPVIAIDSFRHMYVFPDFKDLSIPNKLKQFVLDLHSGKLHREFHHGPDPTDVAPGQHIQDVASSPPESSFQKLAPSEYRYTLLRDRDEL",
        "proteome": "UP000007648",
        "gene": "ERP44",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "d56d3b555281ff9ca7f6f317f5e3b42df8e05b8e",
        "counters": {
            "domain_architectures": 5737,
            "entries": 14,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "profile": 1,
                "ssf": 1,
                "cathgene3d": 1,
                "cdd": 3,
                "pfam": 2,
                "panther": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5737
        }
    }
}