GET /api/protein/UniProt/G3WBK4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3WBK4",
        "id": "G3WBK4_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "Mitochondrial GTPase 1",
        "description": [
            "Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays mitochondrial GTPase activity"
        ],
        "length": 336,
        "sequence": "MRVPAGALWSAAVTSWRSGFSFAGQEVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQETLGIKPHLLVLNKMDLADLKEKQKILGRLNKEGVKNVIFTNCLKDENIKQIVPTVTELIESGYRYHRGENLEYCIMVIGVPNVGKSSLINSLRRQHLKKGKASRVGGDPGITRAVMSKIQVCERPLMFLLDTPGVLAPRIPDVETGLKLATCGTILDHLVGEDIIADYLLFSLNKQQQFRYVEHYDLGEACDDIGSVLKRIAIKLKKIHKVKVLTGTGDVNVIQPNYSAAAYDFIRSFRNGLLGQVMFDTAILEEPQENTVLPPE",
        "proteome": "UP000007648",
        "gene": "MTG1",
        "go_terms": [
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "4b93c256160c3eea4f0633720a92f3a06a024d5d",
        "counters": {
            "domain_architectures": 70445,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "ssf": 1,
                "profile": 1,
                "cathgene3d": 2,
                "panther": 1,
                "pirsf": 1,
                "pfam": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 70445
        }
    }
}