GET /api/protein/UniProt/G3WBK4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3WBK4",
"id": "G3WBK4_SARHA",
"source_organism": {
"taxId": "9305",
"scientificName": "Sarcophilus harrisii",
"fullName": "Sarcophilus harrisii (Tasmanian devil)"
},
"name": "Mitochondrial GTPase 1",
"description": [
"Plays a role in the regulation of the mitochondrial ribosome assembly and of translational activity. Displays mitochondrial GTPase activity"
],
"length": 336,
"sequence": "MRVPAGALWSAAVTSWRSGFSFAGQEVARWFPGHMAKGLKKMQSSLKLVDCIIEVHDARIPLSGRNPLFQETLGIKPHLLVLNKMDLADLKEKQKILGRLNKEGVKNVIFTNCLKDENIKQIVPTVTELIESGYRYHRGENLEYCIMVIGVPNVGKSSLINSLRRQHLKKGKASRVGGDPGITRAVMSKIQVCERPLMFLLDTPGVLAPRIPDVETGLKLATCGTILDHLVGEDIIADYLLFSLNKQQQFRYVEHYDLGEACDDIGSVLKRIAIKLKKIHKVKVLTGTGDVNVIQPNYSAAAYDFIRSFRNGLLGQVMFDTAILEEPQENTVLPPE",
"proteome": "UP000007648",
"gene": "MTG1",
"go_terms": [
{
"identifier": "GO:0005525",
"name": "GTP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "4b93c256160c3eea4f0633720a92f3a06a024d5d",
"counters": {
"domain_architectures": 70445,
"entries": 13,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cdd": 1,
"ssf": 1,
"profile": 1,
"cathgene3d": 2,
"panther": 1,
"pirsf": 1,
"pfam": 1,
"interpro": 5
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 70445
}
}
}