General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3VUK2",
        "id": "G3VUK2_SARHA",
        "source_organism": {
            "taxId": "9305",
            "scientificName": "Sarcophilus harrisii",
            "fullName": "Sarcophilus harrisii (Tasmanian devil)"
        },
        "name": "1-acyl-sn-glycerol-3-phosphate acyltransferase delta",
        "description": [
            "Converts 1-acyl-sn-glycerol-3-phosphate (lysophosphatidic acid or LPA) into 1,2-diacyl-sn-glycerol-3-phosphate (phosphatidic acid or PA) by incorporating an acyl moiety at the sn-2 position of the glycerol backbone. Exhibits high acyl-CoA specificity for polyunsaturated fatty acyl-CoA, especially docosahexaenoyl-CoA (22:6-CoA, DHA-CoA)"
        ],
        "length": 377,
        "sequence": "MDLIGFLKSQFLCHLIICYIFIVSGLIINTIQLFTLVLWPINKQLFRKINCRLAYCISSQLVMLLEWWSGTQCTLYTEPKDYGKYGKENAIVILNHNFEIDFLCGWNFCERFGVLGSSKVLAKKELSYVPVIGWMWYFLEIVFCSRKWEEDRETVIRGLVNLRDYPENFWFLIHCEGTRFTQQKHQISMQVAESKGLPKLKYHLLPRTKGFAVTVKCLRNVVAAVYDSTLNFKNNENPTLLGVLSGKKYHADLYVRRIPLEEVPEDEEECSRWLHKLYQEKDAFQEGYYRTGTYPGTPIVPPRRPWTLLCWLFWALLLLYPLFRLVVNMISSGSSLTLASFALVIFVASVGVRRMIGVTEINKGSTYGNNDSKQKSK",
        "proteome": "UP000007648",
        "gene": "AGPAT4",
        "go_terms": [
            {
                "identifier": "GO:0016746",
                "name": "acyltransferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "576aa5c03756d516bfa9713437eb91134b70fefe",
        "counters": {
            "domain_architectures": 10892,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "pfam": 2,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 10892
        }
    }
}