GET /api/protein/UniProt/G3T067/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3T067",
        "id": "G3T067_LOXAF",
        "source_organism": {
            "taxId": "9785",
            "scientificName": "Loxodonta africana",
            "fullName": "Loxodonta africana (African elephant)"
        },
        "name": "Nuclear receptor-binding factor 2",
        "description": [
            "Involved in starvation-induced autophagy probably by its association with PI3K complex I (PI3KC3-C1). However, effects has been described variably. Involved in the induction of starvation-induced autophagy. Stabilizes PI3KC3-C1 assembly and enhances ATG14-linked lipid kinase activity of PIK3C3. Proposed to negatively regulate basal and starvation-induced autophagy and to inhibit PIK3C3 activity by modulating interactions in PI3KC3-C1. May be involved in autophagosome biogenesis. May play a role in neural progenitor cell survival during differentiation",
            "May modulate transcriptional activation by target nuclear receptors. Can act as transcriptional activator (in vitro)"
        ],
        "length": 288,
        "sequence": "MEVMEGPLNLAHQQSRRADRLLAAGKYEEAISCHKKAAAYLSEAMKLTQSEQAHLSLELQRDSHMKQLLLIQERWKRAKREERLKAQQSTDRDIANYLQASHRPSAEDAEGQSPLVLQKGSPSTEKHLPENQRVFDRDPDTLLFLLQQKSEPTEPCIGSKAPKDDKTIIEEQATKIAALKRHVEFLVAENERLRKENKQLKAEKARLLKGPVEKELDVDADFVETSELWSLPPHSETPAVSSTWQEFATNSGKAKDIPIPNLPPLDFPSPELPLMELSEDILKGLMNN",
        "proteome": "UP000007646",
        "gene": "NRBF2",
        "go_terms": [
            {
                "identifier": "GO:0006914",
                "name": "autophagy",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "7554e71c3ca00fab3156fcb8d1f73b85de366e72",
        "counters": {
            "domain_architectures": 1036,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "pfam": 2,
                "ssf": 1,
                "panther": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1036
        }
    }
}