GET /api/protein/UniProt/G3S7T7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3S7T7",
"id": "G3S7T7_GORGO",
"source_organism": {
"taxId": "9595",
"scientificName": "Gorilla gorilla gorilla",
"fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
},
"name": "Ig-like domain-containing protein",
"description": [
"Involved in the presentation of foreign antigens to the immune system"
],
"length": 370,
"sequence": "MRVTAPRTLLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEDGSHTLQSMYGCDLGPDGRLLRGYSQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGRETLQRADTPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEERYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVTAVICRRKSSGGKGGSCSQAACSNSAQGSDESLITCKGEILGS",
"proteome": "UP000001519",
"gene": "LOC101142998",
"go_terms": [
{
"identifier": "GO:0006955",
"name": "immune response",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0019882",
"name": "antigen processing and presentation",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "de28529b7dc033122c351e3dde4684c58e94bf15",
"counters": {
"domain_architectures": 13753,
"entries": 24,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"profile": 1,
"smart": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 11
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 13753
}
}
}