GET /api/protein/UniProt/G3S7T7/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3S7T7",
        "id": "G3S7T7_GORGO",
        "source_organism": {
            "taxId": "9595",
            "scientificName": "Gorilla gorilla gorilla",
            "fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
        },
        "name": "Ig-like domain-containing protein",
        "description": [
            "Involved in the presentation of foreign antigens to the immune system"
        ],
        "length": 370,
        "sequence": "MRVTAPRTLLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGEPRAPWVEQEGPEYWDRETQKYKRQAQTDRVNLRKLRGYYNQSEDGSHTLQSMYGCDLGPDGRLLRGYSQFAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGTCVEWLRRYLENGRETLQRADTPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWAAVVVPSGEEERYTCHVQHEGLPKPLTLRWEPSSQSTIPIVGIVAGLAVLAVVVIGAVVTAVICRRKSSGGKGGSCSQAACSNSAQGSDESLITCKGEILGS",
        "proteome": "UP000001519",
        "gene": "LOC101142998",
        "go_terms": [
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0019882",
                "name": "antigen processing and presentation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "de28529b7dc033122c351e3dde4684c58e94bf15",
        "counters": {
            "domain_architectures": 13753,
            "entries": 24,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "cathgene3d": 2,
                "ssf": 2,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "panther": 1,
                "prints": 1,
                "prosite": 1,
                "interpro": 11
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 13753
        }
    }
}