GET /api/protein/UniProt/G3S1Q1/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3S1Q1",
"id": "G3S1Q1_GORGO",
"source_organism": {
"taxId": "9595",
"scientificName": "Gorilla gorilla gorilla",
"fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
},
"name": "Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex",
"description": [
"The branched-chain alpha-keto dehydrogenase complex catalyzes the overall conversion of alpha-keto acids to acyl-CoA and CO(2). It contains multiple copies of three enzymatic components: branched-chain alpha-keto acid decarboxylase (E1), lipoamide acyltransferase (E2) and lipoamide dehydrogenase (E3). Within this complex, the catalytic function of this enzyme is to accept, and to transfer to coenzyme A, acyl groups that are generated by the branched-chain alpha-keto acid decarboxylase component"
],
"length": 482,
"sequence": "MAAVRMLRTWSRNAGKLICVRYFQTCGNVHVLKPNYVCFFGYPSFKYSHPHHFLKTTAALRGQVVQFKLSDIGEGIREVTVKEWYVKEGDTVSQFDSICEVQSDKASVTITSRYDGVIKKLYYNLDDIAYVGKPLVDIETEALKDSEEDVVETPAVSHDEHTHQEIKGRKTLATPAVRRLAMENNIKLSEVVGSGKDGRILKEDILNYLEKQTGAILPPSPKVEIMPPPPKPKDMTVPILVSKPPVFTGKDKTEPIKGFQKAMVKTMSAALKIPHFGYCDEIDLTELVKLREELKPIAFARGIKLSFMPFFLKAASLGLLQFPILNASVDENCQNITYKASHNIGIAMDTEQGLIVPNVKNVQICSIFDIATELNRLQKLGSVGQLGTTDLTGGTFTLSNIGSIGGTFAKPVIMPPEVAIGALGSIKAIPRFNQKGEVYKAQIMNVSWSADHRVIDGATMSRFSNLWKSYLENPAFMLLDLK",
"proteome": "UP000001519",
"gene": "DBT",
"go_terms": [
{
"identifier": "GO:0016746",
"name": "acyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bbd520f5b63797d180c3669bf95949a50069b7e7",
"counters": {
"domain_architectures": 47733,
"entries": 22,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"profile": 2,
"ssf": 3,
"cdd": 1,
"pfam": 3,
"panther": 1,
"prosite": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 47733
}
}
}