GET /api/protein/UniProt/G3R0C2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3R0C2",
        "id": "G3R0C2_GORGO",
        "source_organism": {
            "taxId": "9595",
            "scientificName": "Gorilla gorilla gorilla",
            "fullName": "Gorilla gorilla gorilla (Western lowland gorilla)"
        },
        "name": "Gamma-secretase subunit APH-1",
        "description": [
            "Potential subunit of the gamma-secretase complex, an endoprotease complex that catalyzes the intramembrane cleavage of integral proteins such as Notch receptors"
        ],
        "length": 216,
        "sequence": "MTAAVFFGCAFIAFGPALALYVFTIATEPLRIIFLIAGAFFWLVSLLISSLVWFMARVIIDNKDGPTQKYLLIFGAFVSVYIQEMFRFAYYKLLKKASEGLKSINPGETAPSMRLLAYAFMTLVIILLHVFWGIVFFDGCEKKKWGILLIVLLTHLLVSAQTFISSYYGINLASAFIILVFMGTWAFLAAGGSCRSLKLCLLCQDKNFLLYNQRSR",
        "proteome": "UP000001519",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0016485",
                "name": "protein processing",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043085",
                "name": "positive regulation of catalytic activity",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "af84851eee3b0d24abe47b86a0182c47ae0b4d6a",
        "counters": {
            "domain_architectures": 3284,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3284
        }
    }
}