GET /api/protein/UniProt/G3QA93/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3QA93",
        "id": "G3QA93_GASAC",
        "source_organism": {
            "taxId": "481459",
            "scientificName": "Gasterosteus aculeatus aculeatus",
            "fullName": "Gasterosteus aculeatus aculeatus (three-spined stickleback)"
        },
        "name": "Adenylosuccinate synthetase",
        "description": [
            "Plays an important role in the de novo pathway and in the salvage pathway of purine nucleotide biosynthesis. Catalyzes the first commited step in the biosynthesis of AMP from IMP",
            "Plays an important role in the de novo pathway of purine nucleotide biosynthesis"
        ],
        "length": 466,
        "sequence": "MSANVNGRETVSLNGEPVVKRPRVSHDSSLRIPKEPHNKVTVVLGAQWGDEGKGKVVDLLAMDADIVCRCQGGNNAGHTVVVDSVEYDFHLLPSGVLNKKALSFIGNGVVIHLPGLFEEAQKNLQKGKGLQGWEERLKISDRAHLVFNFHQAVDGIQEQQRQQQEGKNLGTTKKGIGPAYSSKAARNGLRVCDLVSDFKVFEDKFRMLAEHFLTMYPNLNLEVDSELAQLKGFAERLGPLVTDGVYFMHQALNGPSKKILVEGANAALLDIDFGTYPFVTSSNCTVGGVCTGLGVPPSYVGRVYGVVKAYTTRVGVGAFPTEQKNETGELLQTRGREFGVTTGRKRRCGWLDLVLVRYAHMVNGFTAIALTKLDILDTVSEIKVGVAYKLDGEPLPSFPANMDVLTRVSVDYETLPGWCCSTESARSFEELPLKAQIYIRFIENFLQVPVKWVGVGKSRESMVKLY",
        "proteome": "UP000007635",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0000166",
                "name": "nucleotide binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0004019",
                "name": "adenylosuccinate synthase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006164",
                "name": "purine nucleotide biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005525",
                "name": "GTP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "37cd307e3eb176206c7f16cb37bf0a0b66a13b7b",
        "counters": {
            "domain_architectures": 35081,
            "entries": 20,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cdd": 1,
                "smart": 1,
                "cathgene3d": 3,
                "pfam": 1,
                "hamap": 1,
                "panther": 1,
                "ncbifam": 2,
                "prosite": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 35081
        }
    }
}