General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3N1V8",
        "id": "G3N1V8_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "Phosphatidylinositol-glycan biosynthesis class X protein",
        "description": [
            "Stabilizing subunit of the glycosylphosphatidylinositol-mannosyltransferase I complex which catalyzes the transfer of the first mannose, via an alpha-1,4 bond from a dolichol-phosphate-mannose (Dol-P-Man) to the glucosaminyl acyl phosphatidylinositol (GlcN-(acyl)PI) intermediate to generate alpha-D-Man-(1->4)-alpha-D-GlcN-(1->6)-(1-radyl,2-acyl-sn-glycero-3-phospho)-2-acyl-inositol and participates in the sixth step of the glycosylphosphatidylinositol-anchor biosynthesis. Probably acts by stabilizing the mannosyltransferase PIGM"
        ],
        "length": 258,
        "sequence": "MAAPAVAVRAVAWLLLWEAAGFTCSPATTFNNTHFVSGIRATCSEIILRQEVLKDGFHRDLLTKVKFGESIEDLQTCRLLIKQYIPTGLFVDPYELASLRERNITEAVMVLENFNIEAPNYLSKESEVLIYARQDSQCIDCFQAFLPVHYRYHRPHVKDGETFIVVHNPDLLMYCDQEFPVLKCWAQSEVTAPCTLNSKDICQWNNMKYKSVYKNLTLQVPVGLTIHTSLVCSVTLLISILCSTLILVAVFKYGHFSL",
        "proteome": "UP000009136",
        "gene": "PIGX",
        "go_terms": [
            {
                "identifier": "GO:0006506",
                "name": "GPI anchor biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005789",
                "name": "endoplasmic reticulum membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "dc0f5d23a280936a163850e5debbac4b1a91c184",
        "counters": {
            "domain_architectures": 4042,
            "entries": 5,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 4042
        }
    }
}