GET /api/protein/UniProt/G3N073/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3N073",
        "id": "G3N073_BOVIN",
        "source_organism": {
            "taxId": "9913",
            "scientificName": "Bos taurus",
            "fullName": "Bos taurus (Bovine)"
        },
        "name": "Keratin-associated protein",
        "description": [
            "In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
        ],
        "length": 268,
        "sequence": "MPSRPPLKHSGSMAFLGYPGNCSGISYRTHCYFPVTASVALCSSDVSPTFGLSLPSSYHGNLWLLDNCQETCGEAPSCDSPSSEPKTCTTTCDRSNSSVPCNSPTGGQICSARETTNVGPSPSCNPCPQTKGYVSDGCTPSQCTSKACQTLGNGFKCFGQLNRLSKSFQPLSHYRLGSFGYKSYQDLGIIPSGLSPSRYITNSCQRQNYLIRNCQCPYDWHRRCPPLSYFARNFRSLSSIPSSFPPLRYLYGGYRPLNYYRSTCNCSC",
        "proteome": "UP000009136",
        "gene": "KRTAP24-1",
        "go_terms": [
            {
                "identifier": "GO:0005198",
                "name": "structural molecule activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045095",
                "name": "keratin filament",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bd035a1b2a08b5019c41a71ee25e29b1851f621c",
        "counters": {
            "domain_architectures": 1472,
            "entries": 4,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 1472
        }
    }
}