GET /api/protein/UniProt/G3N073/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3N073",
"id": "G3N073_BOVIN",
"source_organism": {
"taxId": "9913",
"scientificName": "Bos taurus",
"fullName": "Bos taurus (Bovine)"
},
"name": "Keratin-associated protein",
"description": [
"In the hair cortex, hair keratin intermediate filaments are embedded in an interfilamentous matrix, consisting of hair keratin-associated proteins (KRTAP), which are essential for the formation of a rigid and resistant hair shaft through their extensive disulfide bond cross-linking with abundant cysteine residues of hair keratins. The matrix proteins include the high-sulfur and high-glycine-tyrosine keratins"
],
"length": 268,
"sequence": "MPSRPPLKHSGSMAFLGYPGNCSGISYRTHCYFPVTASVALCSSDVSPTFGLSLPSSYHGNLWLLDNCQETCGEAPSCDSPSSEPKTCTTTCDRSNSSVPCNSPTGGQICSARETTNVGPSPSCNPCPQTKGYVSDGCTPSQCTSKACQTLGNGFKCFGQLNRLSKSFQPLSHYRLGSFGYKSYQDLGIIPSGLSPSRYITNSCQRQNYLIRNCQCPYDWHRRCPPLSYFARNFRSLSSIPSSFPPLRYLYGGYRPLNYYRSTCNCSC",
"proteome": "UP000009136",
"gene": "KRTAP24-1",
"go_terms": [
{
"identifier": "GO:0005198",
"name": "structural molecule activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0045095",
"name": "keratin filament",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bd035a1b2a08b5019c41a71ee25e29b1851f621c",
"counters": {
"domain_architectures": 1472,
"entries": 4,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1472
}
}
}