GET /api/protein/UniProt/G3K3Y2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3K3Y2",
"id": "G3K3Y2_9EURO",
"source_organism": {
"taxId": "1033844",
"scientificName": "Exophiala opportunistica",
"fullName": "Exophiala opportunistica"
},
"name": "Actin",
"description": [
"Actins are highly conserved proteins that are involved in various types of cell motility and are ubiquitously expressed in all eukaryotic cells"
],
"length": 161,
"sequence": "LPHAISRVDMAGRDLTDYLMKILAERGYPFSTTAEREIVRDIKEKLCYVALDFEQEIQTAAQSSSLEKSYELPDGQVIAIGNERFRAPEALFQPSVLGLESGGIHVTTFNSIMKCDVDVRKDLYGNIVMSGGTTMYPGISDRMQKEITALAPSSMKVKIIA",
"proteome": null,
"gene": "act",
"go_terms": null,
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": true,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "7c3fd5f9f93389082cb00e4f32e34df39e168dec",
"counters": {
"domain_architectures": 86462,
"entries": 8,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"smart": 1,
"ssf": 1,
"panther": 1,
"pfam": 1,
"interpro": 2
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 86462
}
}
}