HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3JQA3",
"id": "G3JQA3_CORMM",
"source_organism": {
"taxId": "983644",
"scientificName": "Cordyceps militaris (strain CM01)",
"fullName": "Cordyceps militaris (strain CM01) (Caterpillar fungus)"
},
"name": "Translation Initiation Factor Eif4e",
"description": [
"Recognizes and binds the 7-methylguanosine-containing mRNA cap during an early step in the initiation of protein synthesis and facilitates ribosome binding by inducing the unwinding of the mRNAs secondary structures"
],
"length": 255,
"sequence": "MAVAAAESANMDKQVDLSTIPISPNGKEESDAVDSGKPVTVFHDKDNFNVKHPLQNKWTLWFTKPPSGKGDNWNDLLKEVITFDSVEEFWGVYNNVAAVSELALKSDYHLFKAGVRPEWEDPQNKHGGKWSYQYKDKRNIDVDRLWLQVVMSAIGETLEEEEDGEVMGVVVNVRKAFYRIGVWTRTLGKSIPGRGDGDVAGGKGRSNEKGRDIVLSIGRRFKEVLELPNSEQVEFSGHTDSANAGSTRAKAKHTI",
"proteome": "UP000001610",
"gene": "CCM_07605",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003743",
"name": "translation initiation factor activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006413",
"name": "translational initiation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e0d210c4f92eabf1f1927af9673d99c73f29b514",
"counters": {
"domain_architectures": 17558,
"entries": 8,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"pfam": 1,
"panther": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 17558
}
}
}