GET /api/protein/UniProt/G3AI86/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G3AI86",
"id": "G3AI86_SPAPN",
"source_organism": {
"taxId": "619300",
"scientificName": "Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)",
"fullName": "Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)"
},
"name": "Cytochrome c oxidase assembly protein COX16, mitochondrial",
"description": [
"Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. May participate in merging the COX1 and COX2 assembly lines"
],
"length": 130,
"sequence": "MAVFGNNVFRGKKEQEAYDRTFAGKYQKLIKKNSFLYFGLPFMLSIVAGSIYLQKFTAIKWEKYDEKYRQLSEEEMLSMVENKRVFDKKDDFYRLQGLLSEHQEEVSNHDYEIVRVKRREEDEPVWPKSK",
"proteome": "UP000000709",
"gene": "SPAPADRAFT_133396",
"go_terms": [
{
"identifier": "GO:0031966",
"name": "mitochondrial membrane",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "93131471f0f8a6284e632ca614784161f29b678c",
"counters": {
"domain_architectures": 3254,
"entries": 3,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"panther": 1,
"pfam": 1,
"interpro": 1
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3254
}
}
}