General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G3AI86",
        "id": "G3AI86_SPAPN",
        "source_organism": {
            "taxId": "619300",
            "scientificName": "Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)",
            "fullName": "Spathaspora passalidarum (strain NRRL Y-27907 / 11-Y1)"
        },
        "name": "Cytochrome c oxidase assembly protein COX16, mitochondrial",
        "description": [
            "Required for the assembly of the mitochondrial respiratory chain complex IV (CIV), also known as cytochrome c oxidase. May participate in merging the COX1 and COX2 assembly lines"
        ],
        "length": 130,
        "sequence": "MAVFGNNVFRGKKEQEAYDRTFAGKYQKLIKKNSFLYFGLPFMLSIVAGSIYLQKFTAIKWEKYDEKYRQLSEEEMLSMVENKRVFDKKDDFYRLQGLLSEHQEEVSNHDYEIVRVKRREEDEPVWPKSK",
        "proteome": "UP000000709",
        "gene": "SPAPADRAFT_133396",
        "go_terms": [
            {
                "identifier": "GO:0031966",
                "name": "mitochondrial membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "93131471f0f8a6284e632ca614784161f29b678c",
        "counters": {
            "domain_architectures": 3254,
            "entries": 3,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "panther": 1,
                "pfam": 1,
                "interpro": 1
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3254
        }
    }
}