General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G2ZB30",
        "id": "G2ZB30_LISIP",
        "source_organism": {
            "taxId": "881621",
            "scientificName": "Listeria ivanovii (strain ATCC BAA-678 / PAM 55)",
            "fullName": "Listeria ivanovii (strain ATCC BAA-678 / PAM 55)"
        },
        "name": "Transcription factor FapR",
        "description": [
            "Transcriptional factor involved in regulation of membrane lipid biosynthesis by repressing genes involved in fatty acid and phospholipid metabolism"
        ],
        "length": 189,
        "sequence": "MKKYSKKDRQLKLQVAIEENPFITDEQLAEKFGVSVQTIRLDRVALSIPELRERIKHVASVNYADAVKSLPIDEVIGEIIDIQLSKSAISIFDVRSEHVFKRNKIARGHHLFAQANSLATAVIPNELALTTQATVRFVRSVNEGERIIAKAKVRPATDNRPITVVDVTSYVGDEVVLKGKFEMYHATQK",
        "proteome": null,
        "gene": "fapR",
        "go_terms": [
            {
                "identifier": "GO:0003700",
                "name": "DNA-binding transcription factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0045717",
                "name": "negative regulation of fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045892",
                "name": "negative regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": null,
        "counters": {
            "domain_architectures": 0,
            "entries": 9,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "ncbifam": 1,
                "pirsf": 1,
                "hamap": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1
        }
    }
}