GET /api/protein/UniProt/G2WCT8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G2WCT8",
"id": "G2WCT8_YEASK",
"source_organism": {
"taxId": "721032",
"scientificName": "Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557)",
"fullName": "Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) (Baker's yeast)"
},
"name": "Pic2p",
"description": [
"Transport of phosphate groups from the cytosol to the mitochondrial matrix"
],
"length": 300,
"sequence": "MESNKQPRKIQLYTKEFYATCTLGGIIACGPTHSSITPLDLVKCRLQVNPKLYTSNLQGFRKIIANEGWKKVYTGFGATFVGYSLQGAGKYGGYEYFKHLYSSWLSPGVTVYLMASATAEFLADIMLCPFEAIKVKQQTTMPPFCNNVVDGWKKMYAESGGMKAFYKGIVPLWCRQIPYTMCKFTSFEKIVQKIYSVLPKKKEEMNALQQISVSFVGGYLAGILCAAVSHPADVMVSKINSERKANESMSVASKRIYQKIGFTGLWNGLMVRIVMIGTLTSFQWLIYDSFKAYVGLPTTG",
"proteome": null,
"gene": "K7_PIC2",
"go_terms": [
{
"identifier": "GO:0005315",
"name": "phosphate transmembrane transporter activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:1990547",
"name": "mitochondrial phosphate ion transmembrane transport",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e037822792ef5f5d7967370632f8bf737b916266",
"counters": {
"domain_architectures": 140476,
"entries": 9,
"isoforms": 0,
"proteomes": 0,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"profile": 2,
"cathgene3d": 1,
"pfam": 1,
"ssf": 1,
"panther": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 140476
}
}
}