HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G2TIA9",
"id": "G2TIA9_HEYCO",
"source_organism": {
"taxId": "345219",
"scientificName": "Heyndrickxia coagulans 36D1",
"fullName": "Heyndrickxia coagulans 36D1"
},
"name": "Small ribosomal subunit protein uS12",
"description": [
"With S4 and S5 plays an important role in translational accuracy",
"Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit"
],
"length": 139,
"sequence": "MPTINQLVRKPRKSKIEKSKSPALNKGYNSFKKINTDLSSPQKRGVCTRVGTMTPKKPNSALRKYARVRLTNGIEVTAYIPGIGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGALDTAGVDNRKQGRSKYGTKKPKEKK",
"proteome": null,
"gene": "rpsL",
"go_terms": [
{
"identifier": "GO:0003735",
"name": "structural constituent of ribosome",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006412",
"name": "translation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0015935",
"name": "small ribosomal subunit",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005840",
"name": "ribosome",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "13eaac6d348153ecc5222422c2b3dd3c662dcd10",
"counters": {
"domain_architectures": 51025,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"cdd": 1,
"pfam": 1,
"hamap": 1,
"ncbifam": 1,
"pirsf": 1,
"panther": 1,
"prints": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 51025
}
}
}