GET /api/protein/UniProt/G2RH60/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G2RH60",
"id": "G2RH60_THETT",
"source_organism": {
"taxId": "578455",
"scientificName": "Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126)",
"fullName": "Thermothielavioides terrestris (strain ATCC 38088 / NRRL 8126)"
},
"name": "Elongin-C",
"description": [
"Essential component of the SCF (SKP1-CUL1-F-box protein) E3 ubiquitin ligase complexes, which mediate the ubiquitination and subsequent proteasomal degradation of target proteins. Controls sulfur metabolite repression, probably by mediating the inactivation or degradation of the metR transcription factor"
],
"length": 107,
"sequence": "MAENKYITLISAEGHEFVVLREAALVSPTIKGMLRGPFVEAQTGRCRFEEIPSPVLEKVVEYFHYWYRYRDKEDVPDMEIPVEMCLELLQAADFFNLDAMQTHRNTL",
"proteome": "UP000008181",
"gene": "THITE_2123297",
"go_terms": [
{
"identifier": "GO:0006511",
"name": "ubiquitin-dependent protein catabolic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "60040bcbb7198711a6088611935a86324e69d474",
"counters": {
"domain_architectures": 5694,
"entries": 10,
"isoforms": 0,
"proteomes": 1,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"ssf": 1,
"cathgene3d": 1,
"smart": 1,
"pfam": 1,
"cdd": 1,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5694
}
}
}