GET /api/protein/UniProt/G2HEJ6/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G2HEJ6",
"id": "G2HEJ6_PANTR",
"source_organism": {
"taxId": "9598",
"scientificName": "Pan troglodytes",
"fullName": "Pan troglodytes (Chimpanzee)"
},
"name": "Large ribosomal subunit protein mL44",
"description": [
"Component of the 39S subunit of mitochondrial ribosome. May have a function in the assembly/stability of nascent mitochondrial polypeptides exiting the ribosome"
],
"length": 332,
"sequence": "MASGLVRLLQQGPRCLLAPVAPKLVPPVRGVKKGFRAAFRFQKELERQRLLRCPPPPVRRSEKPNWDYHAEIQAFGHRLQENFSLDLLKTAFVNSCYIKSEEAKRQQLGIEKEAVLLNLKSNQELSEQGTSFSQTCLTQFLEDEYPDMPTEGIKNLVDFLTGEEVVCHVARNLAVEQLTLSEEFPVPPTVLQQTFFAVIGALLQSSGPERTALFIRDFLITQMTGKELFEMWKIINPMGLLVEELKKRNVSAPESRLTRQSGGTTALPLYFVGLYCDKKLIAEGPGETVLVAEEEAARVALRKLYGFTENRRPWNYSKPKETLRAEKSITAS",
"proteome": null,
"gene": null,
"go_terms": [
{
"identifier": "GO:0004525",
"name": "ribonuclease III activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0003725",
"name": "double-stranded RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 2,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "69ed2c472e97ed6c19a89b33b1f73992200a63f8",
"counters": {
"domain_architectures": 1656,
"entries": 13,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"pfam": 2,
"cdd": 1,
"profile": 1,
"panther": 1,
"interpro": 4
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 1656
}
}
}