General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1TQV6",
        "id": "G1TQV6_RABIT",
        "source_organism": {
            "taxId": "9986",
            "scientificName": "Oryctolagus cuniculus",
            "fullName": "Oryctolagus cuniculus (Rabbit)"
        },
        "name": "Proto-oncogene serine/threonine-protein kinase mos",
        "description": [
            "Serine/threonine kinase involved in the regulation of MAPK signaling. Is an activator of the ERK1/2 signaling cascade playing an essential role in the stimulation of oocyte maturation"
        ],
        "length": 348,
        "sequence": "MPSPLVLRRCLAASELSPSVDSRPCSSPSELPGKTGKLFLGATPPRAPRLPRRLAWCSIDWEQVCLLRRLGAGGFGSVYKATYRGVPVAIKQVNRCTKNLRASQRSFWAELNIARLRHDNIVRVVAASTRTPAGSNSLGTIIMEFGGDVTLHQVIYGAPGLAAEESEAPHHGTGEQLSLGKCLQYSLDVVNGLLFLHSQSIVHLDLKPANILISERDVCKIGDFGCSERLEDQRCCPPYHLGGTYTHRAPEILKGEAATPKADIYSFAITLWQMATKEVPYSGERQYVLYAVVAYNLRPSLCAAVFRDTVPGQRLGDIIESGWRASALQRPSADRLLVDLKSLTTEFT",
        "proteome": "UP000001811",
        "gene": "MOS",
        "go_terms": [
            {
                "identifier": "GO:0004672",
                "name": "protein kinase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005524",
                "name": "ATP binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006468",
                "name": "protein phosphorylation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "726173b0dde7bbc50c5d845a39c992d18faf18f3",
        "counters": {
            "domain_architectures": 887312,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 2,
                "cdd": 1,
                "profile": 1,
                "smart": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 2,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 887312
        }
    }
}