HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G1RZQ8",
"id": "G1RZQ8_NOMLE",
"source_organism": {
"taxId": "61853",
"scientificName": "Nomascus leucogenys",
"fullName": "Nomascus leucogenys (Northern white-cheeked gibbon)"
},
"name": "Glucagon / GIP / secretin / VIP family domain-containing protein",
"description": [
"VIP is a neuropeptide involved in a diverse array of physiological processes through activating the PACAP subfamily of class B1 G protein-coupled receptors: VIP receptor 1 (VPR1) and VIP receptor 2 (VPR2). Abundantly expressed throughout the CNS and peripheral nervous systems where they primarily exert neuroprotective and immune modulatory roles. Also causes vasodilation, lowers arterial blood pressure, stimulates myocardial contractility, increases glycogenolysis and relaxes the smooth muscle of trachea, stomach and gall bladder"
],
"length": 170,
"sequence": "MDTRNKAQLLVLLTLLSVLFSQTSAWPLYRAPSALRLGDRIPFEGANEPDQVSLKEDIDILQNALAENDTPYYDVSRNARHADGVFTSDFSKLLGQLSAKKYLESLMGKRISSNISEDPVPVKRHSDAVFTDNYTRLRKQMAVKKYLNSILNGKRSSEGESPDFPEELEK",
"proteome": "UP000001073",
"gene": "VIP",
"go_terms": [
{
"identifier": "GO:0005179",
"name": "hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0005576",
"name": "extracellular region",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005184",
"name": "neuropeptide hormone activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "37d543d0993550d37cae5f6d626f4a3e80bcdd30",
"counters": {
"domain_architectures": 3179,
"entries": 7,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"smart": 1,
"cathgene3d": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 2
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 3179
}
}
}