GET /api/protein/UniProt/G1QSM9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G1QSM9",
"id": "G1QSM9_NOMLE",
"source_organism": {
"taxId": "61853",
"scientificName": "Nomascus leucogenys",
"fullName": "Nomascus leucogenys (Northern white-cheeked gibbon)"
},
"name": "Zinc finger protein 706",
"description": [
"Transcription repressor involved in the exit of embryonic stem cells (ESCs) from self-renewal. Acts by repressing expression of KLF4"
],
"length": 76,
"sequence": "MARGQQKIQSQQKNAKKQAGQKKKQGHDQKAAAKAALIYTCTVCRTQMPDPKTFKQHFESKHPKTPLPPELADVQA",
"proteome": "UP000001073",
"gene": "ZNF706",
"go_terms": null,
"protein_evidence": 4,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "40e5226df4688c4bca64e7d2220e6d1fd4142a3c",
"counters": {
"domain_architectures": 1087,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"pfam": 2,
"panther": 1,
"interpro": 4
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1087
}
}
}