GET /api/protein/UniProt/G1QNA8/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1QNA8",
        "id": "G1QNA8_NOMLE",
        "source_organism": {
            "taxId": "61853",
            "scientificName": "Nomascus leucogenys",
            "fullName": "Nomascus leucogenys (Northern white-cheeked gibbon)"
        },
        "name": "Interleukin-1",
        "description": [
            "Anti-inflammatory antagonist of interleukin-1 family of proinflammatory cytokines such as interleukin-1beta/IL1B and interleukin-1alpha/IL1A. Protects from immune dysregulation and uncontrolled systemic inflammation triggered by IL1 for a range of innate stimulatory agents such as pathogens"
        ],
        "length": 159,
        "sequence": "MALETVCRPFGRKSSKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIKPHALFLGIHGGKMCLSCVKSGDETRLQLEAVNITDLSENRKQDKRFTFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVVVTKFYFQEDE",
        "proteome": "UP000001073",
        "gene": "IL1RN",
        "go_terms": [
            {
                "identifier": "GO:0005125",
                "name": "cytokine activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006954",
                "name": "inflammatory response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006955",
                "name": "immune response",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005615",
                "name": "extracellular space",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0005149",
                "name": "interleukin-1 receptor binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f15e08d01e5229ef19b1a28db55baa490c1fdc29",
        "counters": {
            "domain_architectures": 3786,
            "entries": 13,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "ssf": 1,
                "pfam": 1,
                "panther": 1,
                "prints": 2,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3786
        }
    }
}