GET /api/protein/UniProt/G1QCN2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1QCN2",
        "id": "G1QCN2_MYOLU",
        "source_organism": {
            "taxId": "59463",
            "scientificName": "Myotis lucifugus",
            "fullName": "Myotis lucifugus (Little brown bat)"
        },
        "name": "Uncharacterized protein",
        "description": null,
        "length": 500,
        "sequence": "SQQTFLQDSFLSTLKMSIQTPPTLLELAAKRLLRDQALAITALEYLPAELFPYLFVPAYHGGHHYQLLKTLAQAWPFTVLPLGVLMHLPPDHAPTRAVGLKAVFDALDVLLAQEVRPRRCKLRVLDLRNTGANFWDMWLGVSMENCSPKGPVTVHSSSPKMKHPLAPLEVFLDLDFNERNRDEFFMHIIQWAQQREGLLHLCCKALRISGVPFQRVRRVLDRVQLDCIQEVDVNCTWDLPTLGTFALYLGQMSNLQRLCLPHIKLLAEEQEQEKQQSFSQFLSQMLRLRHLQELHMHSPSFLRDHLDQMLRCLQTPLDLLCLTYCERLTHSDLTHLFQCPNLRQLKILHLCGLSLGDFSLEPLRALLEAVAPTLQGLGLDKCGMADSQVEAILPALSRCHQLRDFTISMNNFPGATVEKLLRHTTGLHSLEFELYPIPLECYGTQGTVNQERLALIQAELTGTLRELGQPRTIHLATKHFRHRKFYKDMEPVMCPCSDPA",
        "proteome": "UP000001074",
        "gene": null,
        "go_terms": [
            {
                "identifier": "GO:0008284",
                "name": "positive regulation of cell population proliferation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0043066",
                "name": "negative regulation of apoptotic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045596",
                "name": "negative regulation of cell differentiation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0045892",
                "name": "negative regulation of DNA-templated transcription",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "290852af13cf4f8f8929b07f8465a2dee1ecfc3b",
        "counters": {
            "domain_architectures": 3276,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 2,
                "cathgene3d": 1,
                "ssf": 1,
                "panther": 1,
                "pirsf": 1,
                "interpro": 5
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 3276
        }
    }
}