General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1Q5Q7",
        "id": "G1Q5Q7_MYOLU",
        "source_organism": {
            "taxId": "59463",
            "scientificName": "Myotis lucifugus",
            "fullName": "Myotis lucifugus (Little brown bat)"
        },
        "name": "Midkine",
        "description": [
            "Secreted protein that functions as cytokine and growth factor and mediates its signal through cell-surface proteoglycan and non-proteoglycan receptors. Regulates many processes like inflammatory response, cell proliferation, cell adhesion, cell growth, cell survival, tissue regeneration, cell differentiation and cell migration"
        ],
        "length": 143,
        "sequence": "WGSRGDLFTAGFALLALTRGGQKEKDKVKKGGPGSECAEWTWGPCTPSSKDCGAGFREGTCGAQTQRLRCRVPCNWKKEFGADCKYKFESWGSCDGSSGTKARQGTLKKARYNAQCQETIRVTKPCAPKTKAKAKAKKGKGKD",
        "proteome": "UP000001074",
        "gene": "MDK",
        "go_terms": [
            {
                "identifier": "GO:0008083",
                "name": "growth factor activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73d3c0a451752511ddb54ca2fe71979430ffbaed",
        "counters": {
            "domain_architectures": 2164,
            "entries": 17,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "ssf": 1,
                "pfam": 2,
                "smart": 1,
                "panther": 1,
                "prosite": 2,
                "prints": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2164
        }
    }
}