GET /api/protein/UniProt/G1P351/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1P351",
        "id": "G1P351_MYOLU",
        "source_organism": {
            "taxId": "59463",
            "scientificName": "Myotis lucifugus",
            "fullName": "Myotis lucifugus (Little brown bat)"
        },
        "name": "Trafficking protein particle complex subunit",
        "description": [
            "Core component of the TRAPP complexes which has a function of guanine nucleotide exchange factor activity for Rab1 GTPase. Plays a role in vesicular transport from endoplasmic reticulum to Golgi and autophagy. May play a role in dendrite postsynaptic membrane trafficking"
        ],
        "length": 219,
        "sequence": "MAIFSVYVVNKAGGLIYHLDSYAPRAEAEKTFSYPLDLLLKLHDERVLVAFGQRDGIRVGHAVLAINGKDVNGKYTADGKEVLEYLGNPANYPVSVRFGRPRLTSNEKLMLASMFHSLFAIGSQLSPEQGSSGIEMLETDTFKLHCFQTLTGIKFVVLADPRQAGIDSLLRKIYEIYSDFALKNPFYSLEMPIRCELFEQNLKLALEVAEKAGTFGPGS",
        "proteome": "UP000001074",
        "gene": "TRAPPC4",
        "go_terms": [
            {
                "identifier": "GO:0016192",
                "name": "vesicle-mediated transport",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0030008",
                "name": "TRAPP complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "01c70fce1f059b606197d5d1a38b4caee0ef25e0",
        "counters": {
            "domain_architectures": 7999,
            "entries": 8,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 1,
                "cathgene3d": 1,
                "smart": 1,
                "cdd": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 7999
        }
    }
}