GET /api/protein/UniProt/G1MCP0/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G1MCP0",
"id": "G1MCP0_AILME",
"source_organism": {
"taxId": "9646",
"scientificName": "Ailuropoda melanoleuca",
"fullName": "Ailuropoda melanoleuca (Giant panda)"
},
"name": "Fibulin-7",
"description": [
"An adhesion molecule that interacts with extracellular matrix molecules in developing teeth and may play important roles in differentiation and maintenance of odontoblasts as well as in dentin formation"
],
"length": 392,
"sequence": "MVPGAPRALLLLLLFAGPASRASQNCLNKQQLLTAIRQLQQVLKGQETRFAEGIRSMKSRLAALHSSVNRVGADAPPVSCPALNAPPDGRKFGSKYLVDHEVHFTCNPGFQLVGPSSVVCLPNGTWTGEQPYCKDIGECSSQPCQNGGTCVEGVTQYKCICPPGRTGSRCQHQAQTDVNECELYGQEGRPRLCMHTCVNTPGSYRCACPSGYRMLADGKSCEDVDECVSPQLVCPQGTMCINTGGDFQCVSPECPEGSGNVSYVKTSPFQCERNPCPMDSRPCRHLPKTISFHYLSLPSNLKTPITLFRMATASAPGRPGPNSLRFGIVGGNSRGHFVMQRSDRQTGELILVQTLEGPQTLEVDVDMSEYLDRSFQANHVSKVTIFVSPYDF",
"proteome": "UP000008912",
"gene": "FBLN7",
"go_terms": [
{
"identifier": "GO:0005509",
"name": "calcium ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "6737fd27a0a1d6eaa4cad27f0a619363bcbff95b",
"counters": {
"domain_architectures": 1045,
"entries": 30,
"isoforms": 0,
"proteomes": 1,
"sets": 4,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"profile": 2,
"ssf": 2,
"smart": 3,
"pfam": 4,
"cdd": 2,
"panther": 1,
"prosite": 4,
"prints": 1,
"interpro": 9
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 1045
}
}
}