HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G1KQE8",
"id": "G1KQE8_ANOCA",
"source_organism": {
"taxId": "28377",
"scientificName": "Anolis carolinensis",
"fullName": "Anolis carolinensis (Green anole)"
},
"name": "RNA-splicing ligase RtcB homolog",
"description": [
"Catalytic subunit of the tRNA-splicing ligase complex that acts by directly joining spliced tRNA halves to mature-sized tRNAs by incorporating the precursor-derived splice junction phosphate into the mature tRNA as a canonical 3',5'-phosphodiester. May act as an RNA ligase with broad substrate specificity, and may function toward other RNAs"
],
"length": 505,
"sequence": "MSRSYNDELQFLDKLDKNCWRIKKGFVPNMNVEGVFYVNDPLEKLMFEELRNSCRGGGAGGFLPAMKQIGNVAALPGIVHRSIGLPDVHSGYGFAIGNMAAFDMDDPEAVVSPGGVGFDINCGVRLLRTNLDECDVQPVKEQLAQSMFDHIPVGVGSKGVIPMNAKDLEEALEMGVDWSLREGYAWAEDKEHCEEYGRMLQADPNKVSARAKKRGLPQLGTLGAGNHYAEIQVVDDIYNEYAAKKMGIDHKGQICVMIHSGSRGLGHQVATDALVAMEKAMKRDKIIVNDRQLACARISSQEGQDYLKGMAAAGNYAWVNRSSMTFLTRQAFAKVFNTTPDDLDMHVIYDVSHNIAKVEQHVVDGKERTLLVHRKGSTRAFPPHHPLIAVDYQLTGQPVLIGGTMGTCSYVLTGTEQGMNETFGTTCHGAGRALSRAKSRRNLDFQDVLDKLADMGIAIRVASPKLVMEEAPESYKNVTDVVNTCHAAGISKKAIKLRPIAVIKG",
"proteome": "UP000001646",
"gene": "RTCB",
"go_terms": [
{
"identifier": "GO:0008452",
"name": "RNA ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006396",
"name": "RNA processing",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0170057",
"name": "RNA ligase (GTP) activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006388",
"name": "tRNA splicing, via endonucleolytic cleavage and ligation",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0072669",
"name": "tRNA-splicing ligase complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "99c5ab04158767e585b01487d81d1c1f83b7d534",
"counters": {
"domain_architectures": 15086,
"entries": 9,
"isoforms": 0,
"proteomes": 1,
"sets": 0,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"ssf": 1,
"hamap": 1,
"panther": 1,
"pfam": 1,
"prosite": 1,
"interpro": 3
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 15086
}
}
}