General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1KF75",
        "id": "G1KF75_ANOCA",
        "source_organism": {
            "taxId": "28377",
            "scientificName": "Anolis carolinensis",
            "fullName": "Anolis carolinensis (Green anole)"
        },
        "name": "Gastric inhibitory polypeptide",
        "description": [
            "Potent stimulator of insulin secretion and relatively poor inhibitor of gastric acid secretion"
        ],
        "length": 149,
        "sequence": "MMAFKVLSLLLVSLSFVLMEENGTRDNTKNSRFLNRRYSEGTLASDYSRTLDNMLKKNFVEWLLNRRENRIDNSLEPSKREVKLPALQERNEGIEVGAKEAKECISWLLSNVGRQRLPLPNGLEDWKNILKQEFMSLLISADLCKAMIM",
        "proteome": "UP000001646",
        "gene": "GIP",
        "go_terms": [
            {
                "identifier": "GO:0005179",
                "name": "hormone activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0005576",
                "name": "extracellular region",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0009749",
                "name": "response to glucose",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0042304",
                "name": "regulation of fatty acid biosynthetic process",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0050796",
                "name": "regulation of insulin secretion",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "ba5087cdf7960881e5ab8f929fb2eb436a64f0cb",
        "counters": {
            "domain_architectures": 2410,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 0,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "smart": 1,
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "interpro": 2
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 2410
        }
    }
}