General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G1BTH5",
        "id": "G1BTH5_9CAUD",
        "source_organism": {
            "taxId": "2920892",
            "scientificName": "Mycobacterium phage RockyHorror",
            "fullName": "Mycobacterium phage RockyHorror"
        },
        "name": "Integrase",
        "description": [
            "Integrase is necessary for integration of the phage into the host genome by site-specific recombination. In conjunction with excisionase, integrase is also necessary for excision of the prophage from the host genome"
        ],
        "length": 429,
        "sequence": "MATKKRRTRGDGAFFQRADGKWMGRVELPPDRNGNRRYKWVSSVDRNTAMAKLKQLRRDVEEGRIATTSSTTVEKWMLHWIDNIHAKRKVRPGVLNDYRAAIHNHINPILGAKRIDKLTPQHVRDLHSEIGASRTAELVHVIVQKALDDAVAEGVATRNVAALVDKPEYRKKKRNGFPADVAQHIIHTAFQVCDEPDAVRIAAGFLTGARRGELLGLRWPYVDNPAQGWITIAWQLQSETRVHGCGDPLPEPSPLSRPDRMPKKPPYWPCGKTRAWACPQSRWDLPAHFEYQECEGSLLFTRPKTDAGWREVPLLPPLYVAMQKLRTDNPHGLVWHKDGKPIDPRSDYDVWRGVFRAAGVIGPTESLPPHNSRHTTSTLLRASGVDEQTRMEILGHASVDAQRIYAHADRARHLEAMQGLSELLPSTFA",
        "proteome": "UP000225925",
        "gene": "44",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0015074",
                "name": "DNA integration",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0006310",
                "name": "DNA recombination",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "3e25756e332b1f170b260800a2db3ce4752088aa",
        "counters": {
            "domain_architectures": 12197,
            "entries": 15,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 2,
                "profile": 2,
                "pfam": 2,
                "ssf": 1,
                "panther": 1,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 12197
        }
    }
}