GET /api/protein/UniProt/G0KUB9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "G0KUB9",
        "id": "G0KUB9_I56A3",
        "source_organism": {
            "taxId": "380337",
            "scientificName": "Influenza A virus (strain A/Equine/Prague/1/1956 H7N7)",
            "fullName": "Influenza A virus (strain A/Equine/Prague/1/1956 H7N7)"
        },
        "name": "Polymerase acidic protein",
        "description": [
            "Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity"
        ],
        "length": 716,
        "sequence": "MEDFVXQCFNPMIVELAEKAMKEYGENPKIETNKFAAICTHLEVCFMYSDFHFIDDRGESIIVESSDPNVLLKHRFEIIEGRDRTIAWTIVNSICNTTKIEKPRFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKXXKTHIHIFSFMGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLXXXXXXXXXXXXXXXXXXEITGTMRRLADQSLPPNFSNLEHFKAYVDGFEPNGFIEGKLSQMSKAVNARIEPFLKATPRPLRLPKGPPCSQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMKTFFGWKEPKIIKPHEKGINPNYLLAWKQTLSEIQDIENEGKIPKIKNMKKTSQLKWALGENMAPEKVDFEDCKDISDLKQYSSDEPEQRSFASWIQNEFNKACELTDSTWIELDEIGEDIAPIEHIASMRRNYFTAEISHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKSRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEVGDMLLRTAIGQVSRPMFLYIRTNGTSKVKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKTETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRDNLEPGTFDIGGLYEAIEECLINDPWVLLNASWFNSFLKHALE",
        "proteome": null,
        "gene": "PA",
        "go_terms": [
            {
                "identifier": "GO:0003723",
                "name": "RNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0039694",
                "name": "viral RNA genome replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": false,
        "in_bfvd": false,
        "ida_accession": "0630fbd2b52ea34697c96d66cbb2d83eb22d9481",
        "counters": {
            "domain_architectures": 99195,
            "entries": 6,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "hamap": 1,
                "pfam": 1,
                "interpro": 3
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 99195
        }
    }
}