GET /api/protein/UniProt/G0KUB9/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G0KUB9",
"id": "G0KUB9_I56A3",
"source_organism": {
"taxId": "380337",
"scientificName": "Influenza A virus (strain A/Equine/Prague/1/1956 H7N7)",
"fullName": "Influenza A virus (strain A/Equine/Prague/1/1956 H7N7)"
},
"name": "Polymerase acidic protein",
"description": [
"Plays an essential role in viral RNA transcription and replication by forming the heterotrimeric polymerase complex together with PB1 and PB2 subunits. The complex transcribes viral mRNAs by using a unique mechanism called cap-snatching. It consists in the hijacking and cleavage of host capped pre-mRNAs. These short capped RNAs are then used as primers for viral mRNAs. The PB2 subunit is responsible for the binding of the 5' cap of cellular pre-mRNAs which are subsequently cleaved after 10-13 nucleotides by the PA subunit that carries the endonuclease activity"
],
"length": 716,
"sequence": "MEDFVXQCFNPMIVELAEKAMKEYGENPKIETNKFAAICTHLEVCFMYSDFHFIDDRGESIIVESSDPNVLLKHRFEIIEGRDRTIAWTIVNSICNTTKIEKPRFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKXXKTHIHIFSFMGEEMATKADYTLDEESRARIKTRLFTIRQEMASRGLXXXXXXXXXXXXXXXXXXEITGTMRRLADQSLPPNFSNLEHFKAYVDGFEPNGFIEGKLSQMSKAVNARIEPFLKATPRPLRLPKGPPCSQRSKFLLMDALKLSIEDPSHEGEGIPLYDAIKCMKTFFGWKEPKIIKPHEKGINPNYLLAWKQTLSEIQDIENEGKIPKIKNMKKTSQLKWALGENMAPEKVDFEDCKDISDLKQYSSDEPEQRSFASWIQNEFNKACELTDSTWIELDEIGEDIAPIEHIASMRRNYFTAEISHCRATEYIMKGVYINTALLNASCAAMDDFQLIPMISKSRTKEGRRKTNLYGFIIKGRSHLRNDTDVVNFVSMEFSLTDPRLEPHKWEKYCVLEVGDMLLRTAIGQVSRPMFLYIRTNGTSKVKMKWGMEMRRCLLQSLQQIESMIEAESSVKEKDMTKEFFENKTETWPIGESPRGVEEGSIGKVCRTLLAKSVFNSLYASPQLEGFSAESRKLLLIVQALRDNLEPGTFDIGGLYEAIEECLINDPWVLLNASWFNSFLKHALE",
"proteome": null,
"gene": "PA",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0039694",
"name": "viral RNA genome replication",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": false,
"in_bfvd": false,
"ida_accession": "0630fbd2b52ea34697c96d66cbb2d83eb22d9481",
"counters": {
"domain_architectures": 99195,
"entries": 6,
"isoforms": 0,
"proteomes": 0,
"sets": 1,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 1,
"hamap": 1,
"pfam": 1,
"interpro": 3
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 99195
}
}
}