HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "G0HEC1",
"id": "G0HEC1_CORVD",
"source_organism": {
"taxId": "858619",
"scientificName": "Corynebacterium variabile (strain DSM 44702 / CIP 107183 / JCM 12073 / NCIMB 30131)",
"fullName": "Corynebacterium variabile (strain DSM 44702 / CIP 107183 / JCM 12073 / NCIMB 30131)"
},
"name": "UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase",
"description": [
"Catalyzes the addition of meso-diaminopimelic acid to the nucleotide precursor UDP-N-acetylmuramoyl-L-alanyl-D-glutamate (UMAG) in the biosynthesis of bacterial cell-wall peptidoglycan"
],
"length": 547,
"sequence": "MTSQTSPSRPTRPTLAQLAELTGGRLVDVAGTAAGVASAEQGQQTVATAAIDARDVPADGLFMAVPGTRAHGARFAGQSAGHSVLTDEEGLGVLVDGSWQGTALVVDDCRQWLGPVAAEIHGHPSRDMTVIGVTGTSGKTTTTYMMERALLGHRHVGLIGTTGTRIDGRKIPTSLTTPEAPTLQALFARMRDEGVTHVVMEVSSHALVLGRVRGVDFDVAGFTNLSQDHLDFHPTMEDYFDAKSMLFTEPQDPAGELPVPVVCVDDEWGRRLAGRTGDATVTVSTDGEAATWQVSDVAVHPDGTQHVTVDRADGQVEYDLSIPGAFNVANATLALATLVAAGEDASIADELAEVSVPGRMEKISGSSPQTAVDFLALVDYAHKPGAVTAVLDTLNGQLDRAAAGGNGATRGRLGVVLGAGGNRDHEKRPKMGAAAAAVADLVIVTDDNPRDEDPATIRAAVLAGAGDAAAQRTDGVSPEIREIGDRAEAIRDAVGWARSGDVVVVAGKGHESGQIIGDTVVDFDDRVELADALAALDLHSDTKDSEA",
"proteome": null,
"gene": "murE",
"go_terms": [
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009058",
"name": "biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0016881",
"name": "acid-amino acid ligase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008360",
"name": "regulation of cell shape",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0051301",
"name": "cell division",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "e6ab2b5b1f832ff43dbb14fcfeb9fea358486a52",
"counters": {
"domain_architectures": 37786,
"entries": 19,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 3,
"ssf": 3,
"pfam": 2,
"hamap": 1,
"panther": 1,
"ncbifam": 3,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 37786
}
}
}