HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F9ZQE6",
"id": "F9ZQE6_ACICS",
"source_organism": {
"taxId": "990288",
"scientificName": "Acidithiobacillus caldus (strain SM-1)",
"fullName": "Acidithiobacillus caldus (strain SM-1)"
},
"name": "Glutamate 5-kinase",
"description": [
"Catalyzes the transfer of a phosphate group to glutamate to form L-glutamate 5-phosphate"
],
"length": 422,
"sequence": "MRQRQHEAVPTPRADVQAQAQRWVVKIGSSLLTNDGTGLDLAWIARWMEQIRHLHRAGKEVVLVSSGAVSAGTALLGWSQRPGDLASRQAAASVGQSALIHHYEKILQQVARPEDPPLHCGQVLLTHDELRNRKRYLNARNILRVLLDRNVLPVVNENDAISYRPIQLGDNDTLAAMVCNLLDADLLVLLTDQDGLFSADPRRDPDACFLAEVTAGDPRLEAIAGGGGSGVGTGGMLAKVKAAARAARSGTATVIAHGRHPDILPELVEGKAIGTFFRVRRPVLKARKRWLSDHLRVPGSLILDDGAVRALREKGRSLLSVGVLRVEGEFHRGDLVACRAQDGREIARGLIDLDASVMRRILGHSRAELEQDPTIADSVVIHRDNLVLADPTGDWTPRQSSRQPPVSVPNPGQEPQEGGATE",
"proteome": "UP000006135",
"gene": "proB",
"go_terms": [
{
"identifier": "GO:0003723",
"name": "RNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0004349",
"name": "glutamate 5-kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0055129",
"name": "L-proline biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0005737",
"name": "cytoplasm",
"category": {
"code": "C",
"name": "cellular_component"
}
},
{
"identifier": "GO:0005524",
"name": "ATP binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0016301",
"name": "kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "447b93935cbad126072b9da9e2f1aaa9b49fe991",
"counters": {
"domain_architectures": 19819,
"entries": 26,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 2,
"profile": 1,
"pfam": 2,
"smart": 1,
"panther": 1,
"pirsf": 1,
"hamap": 1,
"ncbifam": 1,
"prints": 1,
"prosite": 1,
"interpro": 10
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 19819
}
}
}