General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9ZC90",
        "id": "F9ZC90_ODOSD",
        "source_organism": {
            "taxId": "709991",
            "scientificName": "Odoribacter splanchnicus (strain ATCC 29572 / DSM 20712 / CIP 104287 / JCM 15291 / NCTC 10825 / 1651/6)",
            "fullName": "Odoribacter splanchnicus (strain ATCC 29572 / DSM 20712 / CIP 104287 / JCM 15291 / NCTC 10825 / 1651/6)"
        },
        "name": "CRISPR-associated exonuclease Cas4",
        "description": [
            "CRISPR (clustered regularly interspaced short palindromic repeat) is an adaptive immune system that provides protection against mobile genetic elements (viruses, transposable elements and conjugative plasmids). CRISPR clusters contain sequences complementary to antecedent mobile elements and target invading nucleic acids. CRISPR clusters are transcribed and processed into CRISPR RNA (crRNA)"
        ],
        "length": 170,
        "sequence": "MINVTGTLINLYQVCKRETWLHANGIRMEHTSDVVTEGKLVHETSYPNRAARYEEVRIGGSVIDFYDPKEKVIHEIKKSTSKEEAYIWQVKYYLLLFEREGIADVVGMLEYPLLRETMRVELEEGDREILRQMEVEIRQLIGEEACPPALSKGKCGACSYYEFCYSGEGE",
        "proteome": "UP000006657",
        "gene": "Odosp_1295",
        "go_terms": null,
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "f980e61197085d6693c5a00d099f0b8e937e8c9f",
        "counters": {
            "domain_architectures": 5123,
            "entries": 7,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "panther": 1,
                "pfam": 1,
                "ncbifam": 1,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 5123
        }
    }
}