GET /api/protein/UniProt/F9X8B2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9X8B2",
        "id": "F9X8B2_ZYMTI",
        "source_organism": {
            "taxId": "336722",
            "scientificName": "Zymoseptoria tritici (strain CBS 115943 / IPO323)",
            "fullName": "Zymoseptoria tritici (strain CBS 115943 / IPO323) (Speckled leaf blotch fungus)"
        },
        "name": "NADH-cytochrome b5 reductase",
        "description": [
            "May mediate the reduction of outer membrane cytochrome b5"
        ],
        "length": 340,
        "sequence": "MFSSRLFRPAQQLSNHVRRYASEAPKSGGGNPILYAVGGVAALGAGAFALSGQKKDPVAVAKELTEPKRENVPPHMGGPPDKVFIGGDQGFISLTLDSTEKINHNTNKFRFKFENPDAVSGLTIASALVTKHKAEGDEKPTIRPYTPTSDEDEKGYMDLIVKKYEGGKMSEHLHSMEPGQKLEMKGPIPKYQWQANKHNHIALLAGGTGITPMWQLARQIFKDPNDKTKVTLVFGNITEEDILLKKEFDDLEKQYPERFRAFYVLDKPSKNWEGGKGFISKELLQKTIPQPDEENVKVFVCGPPGLVKAISGPKKSPADQGDLAGTLKEMGYSKDQVFKF",
        "proteome": "UP000008062",
        "gene": "MYCGRDRAFT_70871",
        "go_terms": [
            {
                "identifier": "GO:0016491",
                "name": "oxidoreductase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2082b5feb2f2dd03d28f68d3ac5b94ba2a479ce4",
        "counters": {
            "domain_architectures": 25887,
            "entries": 18,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "ssf": 2,
                "cathgene3d": 2,
                "profile": 1,
                "pfam": 2,
                "cdd": 1,
                "panther": 1,
                "prints": 2,
                "interpro": 7
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 25887
        }
    }
}