HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F9TB79",
"id": "F9TB79_9VIBR",
"source_organism": {
"taxId": "1051646",
"scientificName": "Vibrio tubiashii ATCC 19109",
"fullName": "Vibrio tubiashii ATCC 19109"
},
"name": "NAD-capped RNA hydrolase NudC",
"description": [
"mRNA decapping enzyme that specifically removes the nicotinamide adenine dinucleotide (NAD) cap from a subset of mRNAs by hydrolyzing the diphosphate linkage to produce nicotinamide mononucleotide (NMN) and 5' monophosphate mRNA. The NAD-cap is present at the 5'-end of some mRNAs and stabilizes RNA against 5'-processing. Has preference for mRNAs with a 5'-end purine. Catalyzes the hydrolysis of a broad range of dinucleotide pyrophosphates"
],
"length": 261,
"sequence": "MLNKSDTNRTKNAYWCVVSGSDIWLQNGQLPKGSAESLNLPYEQAIEVGRWENYPLMWLNEADVSEELELTSLRDCLHFPEPLFLLMSKAIQYGHMSQSLRFCPQCGGRNHLNHNQLAMQCGDCRTLHYPRIFPCIIVAVRNKQQILLAQHPRHRNGMYTVIAGFLEVGETLEQCVAREVKEETGIAVTNIRYFGSQPWAFPSSMMMGFVADYQSGELKPDYSELSDARWFGIEELPPVAPTGTIARQLIEYTLDEIKLSS",
"proteome": "UP000003836",
"gene": "nudC",
"go_terms": [
{
"identifier": "GO:0016787",
"name": "hydrolase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0046872",
"name": "metal ion binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0000210",
"name": "NAD+ diphosphatase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "3699a44c1f8bf9d98308f8700bb15e18a36a8aa4",
"counters": {
"domain_architectures": 5154,
"entries": 20,
"isoforms": 0,
"proteomes": 1,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 1,
"pfam": 2,
"profile": 1,
"cdd": 1,
"hamap": 1,
"ncbifam": 1,
"panther": 1,
"prosite": 1,
"prints": 1,
"interpro": 8
},
"proteome": 1,
"taxonomy": 1,
"similar_proteins": 5154
}
}
}