General Handler

HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9T8V1",
        "id": "F9T8V1_9VIBR",
        "source_organism": {
            "taxId": "1051646",
            "scientificName": "Vibrio tubiashii ATCC 19109",
            "fullName": "Vibrio tubiashii ATCC 19109"
        },
        "name": "CobW C-terminal domain-containing protein",
        "description": [
            "Zinc chaperone that directly transfers zinc cofactor to target proteins, thereby activating them. Zinc is transferred from the CXCC motif in the GTPase domain to the zinc binding site in target proteins in a process requiring GTP hydrolysis"
        ],
        "length": 404,
        "sequence": "MASVPVTILHGFLGSGKTTLLRSILQQAESKRIELSVIVNDMSELDVDGVLIANTDAVSEDKGNFVTLSGQSISSPEGIKQLDASLTQLCQDESPDWIVIETSGSSHPLPLVEYFKDQNQFSLKDVVTLVDATWLRDDYRQGVDLIPKWQQNMQQGTRGVEDLLVEQIMFSNRIFLTKTDKVDDRTIGNIAQAIHPLNIYAEIIKTSWGNINIASLKSQTDYNFHLVEQLLNELKGNVNRPLNLSGKEDQQITAKVIKDDRPFHPMRLWEACHQHLTKGVFRSKGFFWFPTRDDVSLLWSQANGNVGLEVTGFWRASVIEDESQNFTIEHKQRLQDKIDSVESRFGDRRCRLTVIGQENEVDNFIDALQACFLNEQELKQWRNGASFEDPWPNKATKLKQHLCY",
        "proteome": "UP000003836",
        "gene": "VITU9109_16898",
        "go_terms": null,
        "protein_evidence": 4,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "b01990a69174835163ad280bc3c756c86276935e",
        "counters": {
            "domain_architectures": 37212,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 3,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "pfam": 2,
                "cdd": 1,
                "smart": 1,
                "panther": 1,
                "interpro": 4
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 37212
        }
    }
}