GET /api/protein/UniProt/F9T622/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9T622",
        "id": "F9T622_9VIBR",
        "source_organism": {
            "taxId": "1051646",
            "scientificName": "Vibrio tubiashii ATCC 19109",
            "fullName": "Vibrio tubiashii ATCC 19109"
        },
        "name": "Phospho-N-acetylmuramoyl-pentapeptide-transferase",
        "description": [
            "Catalyzes the initial step of the lipid cycle reactions in the biosynthesis of the cell wall peptidoglycan: transfers peptidoglycan precursor phospho-MurNAc-pentapeptide from UDP-MurNAc-pentapeptide onto the lipid carrier undecaprenyl phosphate, yielding undecaprenyl-pyrophosphoryl-MurNAc-pentapeptide, known as lipid I"
        ],
        "length": 360,
        "sequence": "MIIWLAELLQPYFSFFRLFEYLSFRAIVSVLTALGISLWMGPIMIRRLQLLQIGQVVRNEGPESHFSKRGTPTMGGIMILTAIVTTALLWADLSNPYVWAVLAVLLGYGAIGFVDDYRKVVRKNTDGLIARWKYFWQSAIALVVAFALYAHGKDTAATQLVVPFFKEVMPQLGLMYIVLTYFVIVGTSNAVNLTDGLDGLAIMPTVLVSAGFAAIAWATGNVNFANYLHIPHIPQASELVVVCTAIVGAGLGFLWFNTYPAQVFMGDVGSLALGGALGTIAVLVRQEFVLVIMGGVFVMETLSVILQVGSYKLRGQRIFRMAPIHHHYELKGWPEPRVIVRFWIISIVLVLIGLATLKVR",
        "proteome": "UP000003836",
        "gene": "mraY",
        "go_terms": [
            {
                "identifier": "GO:0008963",
                "name": "phospho-N-acetylmuramoyl-pentapeptide-transferase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0016020",
                "name": "membrane",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            },
            {
                "identifier": "GO:0016780",
                "name": "phosphotransferase activity, for other substituted phosphate groups",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "2ac8b9a4fe21e5a48ddf7041506e7bbf9d403da3",
        "counters": {
            "domain_architectures": 19949,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 1,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cdd": 1,
                "pfam": 2,
                "panther": 1,
                "hamap": 1,
                "ncbifam": 1,
                "prosite": 2,
                "interpro": 3
            },
            "proteome": 1,
            "taxonomy": 1,
            "similar_proteins": 19949
        }
    }
}