GET /api/protein/UniProt/F9NYQ4/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9NYQ4",
        "id": "F9NYQ4_STROR",
        "source_organism": {
            "taxId": "768726",
            "scientificName": "Streptococcus mitis bv. 2 str. F0392",
            "fullName": "Streptococcus mitis bv. 2 str. F0392"
        },
        "name": "Beta sliding clamp",
        "description": [
            "Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loading complex) which diffuses in an ATP-independent manner freely and bidirectionally along dsDNA. Initially characterized for its ability to contact the catalytic subunit of DNA polymerase III (Pol III), a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria; Pol III exhibits 3'-5' exonuclease proofreading activity. The beta chain is required for initiation of replication as well as for processivity of DNA replication"
        ],
        "length": 378,
        "sequence": "MIHFSINKNLFLQALNTTKRAISSKNAIPILSTIKIDVTNEGITLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQKQIVLTSGKSEITLKGKDSEQYPRIQEISASTPLVLETKLLKKIINETAFAASTQESRPILTGVHFVLSQHKELKTVATDSHRLSQKKLTLEKNGDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFDVVNLRQSMERARLLSSATQNGTVKLEIKGGVVSAHVHSPEVGKVNEEIDTEQVTGDDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN",
        "proteome": null,
        "gene": "dnaN",
        "go_terms": [
            {
                "identifier": "GO:0003677",
                "name": "DNA binding",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0003887",
                "name": "DNA-directed DNA polymerase activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0008408",
                "name": "3'-5' exonuclease activity",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006260",
                "name": "DNA replication",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0009360",
                "name": "DNA polymerase III complex",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "bfad543c1c3a99ab704fbd29a259ed902f9a9bab",
        "counters": {
            "domain_architectures": 26841,
            "entries": 16,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 2,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "pfam": 3,
                "ssf": 1,
                "cdd": 1,
                "cathgene3d": 2,
                "smart": 1,
                "panther": 1,
                "pirsf": 1,
                "ncbifam": 1,
                "interpro": 5
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 26841
        }
    }
}