HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F9NYQ4",
"id": "F9NYQ4_STROR",
"source_organism": {
"taxId": "768726",
"scientificName": "Streptococcus mitis bv. 2 str. F0392",
"fullName": "Streptococcus mitis bv. 2 str. F0392"
},
"name": "Beta sliding clamp",
"description": [
"Confers DNA tethering and processivity to DNA polymerases and other proteins. Acts as a clamp, forming a ring around DNA (a reaction catalyzed by the clamp-loading complex) which diffuses in an ATP-independent manner freely and bidirectionally along dsDNA. Initially characterized for its ability to contact the catalytic subunit of DNA polymerase III (Pol III), a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria; Pol III exhibits 3'-5' exonuclease proofreading activity. The beta chain is required for initiation of replication as well as for processivity of DNA replication"
],
"length": 378,
"sequence": "MIHFSINKNLFLQALNTTKRAISSKNAIPILSTIKIDVTNEGITLIGSNGQISIENFISQKNEDAGLLITSLGSILLEASFFINVVSSLPDVTLDFKEIEQKQIVLTSGKSEITLKGKDSEQYPRIQEISASTPLVLETKLLKKIINETAFAASTQESRPILTGVHFVLSQHKELKTVATDSHRLSQKKLTLEKNGDDFDVVIPSRSLREFSAVFTDDIETVEIFFANNQILFRSENISFYTRLLEGNYPDTDRLIPTDFNTTITFDVVNLRQSMERARLLSSATQNGTVKLEIKGGVVSAHVHSPEVGKVNEEIDTEQVTGDDLTISFNPTYLIDSLKALNSEKVTISFISAVRPFTLVPADTDEDFMQLITPVRTN",
"proteome": null,
"gene": "dnaN",
"go_terms": [
{
"identifier": "GO:0003677",
"name": "DNA binding",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0003887",
"name": "DNA-directed DNA polymerase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0008408",
"name": "3'-5' exonuclease activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0006260",
"name": "DNA replication",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0009360",
"name": "DNA polymerase III complex",
"category": {
"code": "C",
"name": "cellular_component"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "bfad543c1c3a99ab704fbd29a259ed902f9a9bab",
"counters": {
"domain_architectures": 26841,
"entries": 16,
"isoforms": 0,
"proteomes": 0,
"sets": 2,
"structures": 0,
"taxa": 1,
"dbEntries": {
"pfam": 3,
"ssf": 1,
"cdd": 1,
"cathgene3d": 2,
"smart": 1,
"panther": 1,
"pirsf": 1,
"ncbifam": 1,
"interpro": 5
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 26841
}
}
}