HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept
{
"metadata": {
"accession": "F9LUF2",
"id": "F9LUF2_STROR",
"source_organism": {
"taxId": "1000588",
"scientificName": "Streptococcus mitis bv. 2 str. SK95",
"fullName": "Streptococcus mitis bv. 2 str. SK95"
},
"name": "Riboflavin biosynthesis protein",
"description": [
"Catalyzes the phosphorylation of riboflavin to FMN followed by the adenylation of FMN to FAD"
],
"length": 308,
"sequence": "MITTVPIKNEKDIAVPGNTVLVLGYFDGIHKGHQKLFEVASKASMKDYLPVVVMTFTESPKLALQPYQPELMLHIVNHEEREHKMKWHGVEALFLLDFSSKFASLTGQEFFDTYIKALKPAIIVAGFDYTFGSDKKTADDLKDYFDGEIIIVPPVEDEKGKISSTRIRQAILDGDVKEVNHLLGTPLPSRGMVVHGNARGRTIGYPTANLVLRDRTYMPADGVYVVDVEVQRQRYRGMASVGKNVTFDGEEPRFEVNIFDFSDDIYGETVMVYWLDRVRDMVKFDSIDELVDQLQKDEEIARNWKDGE",
"proteome": null,
"gene": "ribF",
"go_terms": [
{
"identifier": "GO:0003919",
"name": "FMN adenylyltransferase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009231",
"name": "riboflavin biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
},
{
"identifier": "GO:0008531",
"name": "riboflavin kinase activity",
"category": {
"code": "F",
"name": "molecular_function"
}
},
{
"identifier": "GO:0009398",
"name": "FMN biosynthetic process",
"category": {
"code": "P",
"name": "biological_process"
}
}
],
"protein_evidence": 3,
"source_database": "unreviewed",
"is_fragment": false,
"in_alphafold": true,
"in_bfvd": false,
"ida_accession": "41291eb7db8f1bd28ba28c58ac3a87da002b8f8e",
"counters": {
"domain_architectures": 24349,
"entries": 18,
"isoforms": 0,
"proteomes": 0,
"sets": 3,
"structures": 0,
"taxa": 1,
"dbEntries": {
"cathgene3d": 2,
"ssf": 2,
"cdd": 1,
"smart": 1,
"pfam": 2,
"ncbifam": 2,
"panther": 1,
"pirsf": 1,
"interpro": 6
},
"proteome": 0,
"taxonomy": 1,
"similar_proteins": 24349
}
}
}