GET /api/protein/UniProt/F9HKL2/?format=api
HTTP 200 OK
Allow: GET, HEAD
Content-Type: application/json
InterPro-Version: 108.0
InterPro-Version-Minor: 0
Vary: Accept

{
    "metadata": {
        "accession": "F9HKL2",
        "id": "F9HKL2_STRMT",
        "source_organism": {
            "taxId": "1008453",
            "scientificName": "Streptococcus mitis SK1080",
            "fullName": "Streptococcus mitis SK1080"
        },
        "name": "Small ribosomal subunit protein uS14",
        "description": [
            "Binds 16S rRNA, required for the assembly of 30S particles and may also be responsible for determining the conformation of the 16S rRNA at the A site"
        ],
        "length": 61,
        "sequence": "MAKKSMIAKNKRPAKFSTQAYTRCEKCGRPHSVYRKFKLCRVCFRELAYKGQIPGVTKASW",
        "proteome": null,
        "gene": "rpsZ",
        "go_terms": [
            {
                "identifier": "GO:0003735",
                "name": "structural constituent of ribosome",
                "category": {
                    "code": "F",
                    "name": "molecular_function"
                }
            },
            {
                "identifier": "GO:0006412",
                "name": "translation",
                "category": {
                    "code": "P",
                    "name": "biological_process"
                }
            },
            {
                "identifier": "GO:0005840",
                "name": "ribosome",
                "category": {
                    "code": "C",
                    "name": "cellular_component"
                }
            }
        ],
        "protein_evidence": 3,
        "source_database": "unreviewed",
        "is_fragment": false,
        "in_alphafold": true,
        "in_bfvd": false,
        "ida_accession": "73a55bc605f5d10b7a90e4800b26c31c42c6bac8",
        "counters": {
            "domain_architectures": 49157,
            "entries": 11,
            "isoforms": 0,
            "proteomes": 0,
            "sets": 1,
            "structures": 0,
            "taxa": 1,
            "dbEntries": {
                "cathgene3d": 1,
                "ssf": 1,
                "ncbifam": 1,
                "hamap": 1,
                "pfam": 1,
                "panther": 1,
                "prosite": 1,
                "interpro": 4
            },
            "proteome": 0,
            "taxonomy": 1,
            "similar_proteins": 49157
        }
    }
}